PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100262770011
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family Dof
Protein Properties Length: 159aa    MW: 17636.8 Da    PI: 7.8679
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100262770011genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof120.94.5e-3847105260
                        zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 
                                   ++k+++cprC+s++tkfCy+nny+++qPr+fC++C+ryWt+GGalrnvPvG+grrk k 
  Ote100262770011|100262770011  47 PDKIIPCPRCKSMETKFCYFNNYNVNQPRHFCRGCQRYWTAGGALRNVPVGAGRRKTKP 105
                                   68999***************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-2946104IPR003851Zinc finger, Dof-type
PfamPF027016.7E-3249104IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.29551105IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105389IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010214Biological Processseed coat development
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 159 aa     Download sequence    Send to blast
MAEVVQEGND SSGIKLFGAT ISVKEASEAK DDEESKKVDD QTAEKRPDKI IPCPRCKSME  60
TKFCYFNNYN VNQPRHFCRG CQRYWTAGGA LRNVPVGAGR RKTKPPCRGL AEGCLFDAPT  120
EVQRLDYDGA EEWGAAEHGG VERLCPAKRR RCGSDSQTC
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00166DAPTransfer from AT1G29160Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011085996.15e-82PREDICTED: dof zinc finger protein DOF1.5-like
SwissprotP683502e-57DOF15_ARATH; Dof zinc finger protein DOF1.5
TrEMBLM5X2T03e-68M5X2T0_PRUPE; Uncharacterized protein
STRINGVIT_10s0003g01260.t012e-64(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA72402232